PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D04G1436
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 263aa    MW: 30453 Da    PI: 8.2116
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D04G1436genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l  +v+++G  +W+  +++ g+ R++k+c++rw++yl
      Gh_D04G1436 14 KGTWTPEEDRKLTAYVTRYGCWNWRQLPKYAGLARCGKSCRLRWLNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding55.51.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ ++eE+e ++++++ lG++ W++Ia+ ++ gRt++++k++w+++l
      Gh_D04G1436  67 RGNYSKEEEETIIRLHESLGNR-WSAIAAQLP-GRTDNEIKNHWHTHL 112
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.644961IPR017930Myb domain
SuperFamilySSF466899.38E-2911108IPR009057Homeodomain-like
SMARTSM007172.2E-91363IPR001005SANT/Myb domain
PfamPF002491.1E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-231568IPR009057Homeodomain-like
CDDcd001676.32E-91661No hitNo description
PROSITE profilePS5129425.21162116IPR017930Myb domain
SMARTSM007174.1E-1766114IPR001005SANT/Myb domain
PfamPF002493.2E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-2669115IPR009057Homeodomain-like
CDDcd001672.44E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MVRTPYCDKS GLRKGTWTPE EDRKLTAYVT RYGCWNWRQL PKYAGLARCG KSCRLRWLNY  60
LRPNIKRGNY SKEEEETIIR LHESLGNRWS AIAAQLPGRT DNEIKNHWHT HLKKRFMDKQ  120
NVRAHFARAQ EKAVEKKEKK LNNHHHLVID VPTSPPLILE SSLSASPQPT SSDQYSTITK  180
DNTVLSSKDS VTYDHNNNNK ASLEGYEASS GNFWNEPFFW DSSNINTSVT LDPASYELPE  240
FPFLDGEISC HFDSYDPLDG FYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012457982.11e-180PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH45e-62MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0D2V6051e-180A0A0D2V605_G
STRINGPOPTR_0013s14560.12e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.12e-60myb domain protein 14